PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000276982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 999aa    MW: 113157 Da    PI: 6.2998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000276982genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.12.8e-563114381128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s
  MDP0000276982 311 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS 405
                    79****************************.99***************6434555777************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  MDP0000276982 406 -QTRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 438
                    .9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF137134.1E-884115IPR027988Transcription factor BREVIS RADIX, N-terminal domain
PROSITE profilePS5151415.187167222IPR013591Brevis radix (BRX) domain
PfamPF083811.4E-14168209IPR013591Brevis radix (BRX) domain
SuperFamilySSF1019411.57E-64304463IPR003441NAC domain
PROSITE profilePS5100561.727311463IPR003441NAC domain
PfamPF023657.8E-30312438IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MGEWGXERGE AMCVGEVREG GXESTMSGAT NAEKCISTSD EMLIEEIQRL TVEAHNLERK  60
CKIGSQKIHE CEQKTEETWS LARDEAATCK AAKEVIKALA LRLKTISEKA SAGKQPNNGI  120
DTKLPQLTPL NTNTKLPEVD SVSDSPAVLS DTPKSEPHGR ETKSAKLEWV EQFEPGVHLT  180
LVVLPNGQKG LKRVNFXRKK FTDKDVERWL EGSIFQYVVG PVNLGAKPWT LVIVGIFFLG  240
PRPSCCTTIT RHLMWDNSQH FLFRCGTTLN TFMINVTQGV VVXFLIFIDG ICHPREEXEE  300
GPSVYMAPVS LPPGFRFHPT DEELVAYYLK RKINGRKIEL EVIPEVDLYK CEPWDLPGKS  360
LLPSKDLEWY FFSPRDRKYP NGSRTNRATK AGYWKATGKD RKVNSQTRAV GMKKTLVYYR  420
GRAPHGIRTN WVMHEYRLDE RECETAQGLQ VQDAYALCRI FKKTATGPKI GEHYGGTSTT  480
NYQLTSDHSS SVNELYSDGG RCEDFESSSY PMQMHNACSS SPNFVHKNSL DDMGRKRDGK  540
WTQFLSKKAF NCSSSFSPFP NHENISYPPS KVDIALECAR LQHRLSPPPL EVEDFPQVGL  600
NDFKTMQYSN PALDTTSTET DALQEILSVA HVSQEMVNQS SNHVDQTWGG NYAPPANDFS  660
FMVDRDAHYN QITDHLNSMR YVDQKTWGNS YTRSIEIGDL KDDFRMENTA ENLRWIGMSD  720
KDLEKSFTEE HKIIPIENIS SFRREEEEQH YEAQGGPGHR SGIIKELNDN EANDDDFSLS  780
FINEDPNENF LHDGNMDDYS TSPSFEVIEE VQVNHGMFVS TRQVAETFFH QLVPSQTVKV  840
HLNPVFGQNL LVERVVTQTK SKDRGSFFER FKELVMEKFD GIAKSTKPWR KIASTLVCAV  900
TLILMHMIIY LGQHMEDEKX MDAFTTTTTA TIVEEKGNSN ISKKEGLGLI KWSNKKEKVC  960
LVNIRDGSTC SVFLKKMGIF LTVSLALGTM WVNHNVIPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5530746311168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381390.10.0PREDICTED: uncharacterized protein LOC103444247 isoform X1
TrEMBLM5XAW60.0M5XAW6_PRUPE; Uncharacterized protein
STRINGVIT_04s0079g00280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-162NAC domain containing protein 28